PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G020300.1
Common NameB456_002G020300, LOC105774229
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 425aa    MW: 46678.6 Da    PI: 6.5112
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G020300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.51.3e-27151204256
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          +++WtpeLH+rFv+aveqL G +kA+P++ilelm++++Lt+++++SHLQkYR++
  Gorai.002G020300.1 151 LKVDWTPELHRRFVQAVEQL-GVDKAVPSRILELMGIDCLTRHNIASHLQKYRSH 204
                         5899****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.748147206IPR017930Myb domain
SuperFamilySSF466894.12E-18149207IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-26149207IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-26150204IPR006447Myb domain, plants
PfamPF002494.5E-8153202IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MLAVSPLRNN TSKDDDEGEM ESTFTISSDE FPDFADGNLL ESIDFDDLFL SIDVDGDVLP  60
DLEMDPEILA ELPPAGEESE MNASGEKTEE SDNQRKDEEE NKVSTSKGDE ESVSKREEPK  120
AVKTGSKDGD KGRKSSIKGK SNNNNQGTRK LKVDWTPELH RRFVQAVEQL GVDKAVPSRI  180
LELMGIDCLT RHNIASHLQK YRSHRKHLLA REAEAASWIH RRQIYGGATP VGGGGKRDVN  240
HWLPPTMGFP PSASPMHHQN HLFRPLHVWG HPTMDQSLMH LWPKHLAPPP PPPRPAWGPP  300
PPADPSFWHH QHHRVPNGQT PGTPCFPPPL TAAPTRFGAV PVPGIPPHHA MYKADTGIGV  360
PASQLRRHPL VDLHPSKESI DAAIGDVLSK PWLPLPIGLK PPSTDGVLVE LQRQGVPKIP  420
PSCA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-15149202457ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5856973e-65JX585697.1 Gossypium hirsutum clone NBRI_GE19344 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012452087.10.0PREDICTED: transcription activator GLK1-like isoform X1
RefseqXP_012452096.10.0PREDICTED: transcription activator GLK1-like isoform X1
SwissprotQ9SIV31e-110GLK1_ARATH; Transcription activator GLK1
TrEMBLA0A0D2QZ290.0A0A0D2QZ29_G
STRINGGLYMA12G33430.11e-172(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22092773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.15e-99GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]